GBP
AEDAFNALLAMDANGAOAARSAUDAWGAZNBAMBBDBDTBGNBHDBIFBMDBNDBOBBRLBSDBTNBWPBYNBZDCADCDFCHFCLFCLPCNHCNYCOPCRCCUCCUPCVECZKDJFDKKDOPDZDEGPERNETBEURFJDFKPGELGGPGHSGIPGMDGNFGTQGYDHKDHNLHRKHTGHUFIDRILSIMPINRIQDIRRISKJEPJMDJODJPYKESKGSKHRKMFKPWKRWKWDKYDKZTLAKLBPLKRLRDLSLLYDMADMDLMGAMKDMMKMNTMOPMRUMURMVRMWKMXNMYRMZNNADNGNNIONOKNPRNZDOMRPABPENPGKPHPPKRPLNPYGQARRONRSDRUBRWFSARSBDSCRSDGSEKSGDSHPSLESLLSOSSRDSSPSTDSTNSVCSYPSZLTHBTJSTMTTNDTOPTRYTTDTWDTZSUAHUGXUSDUYUUZSVESVNDVUVWSTXAFXCDXCGXOFXPFYERZARZMWZWGZWL
Default
France FranceGermany Germany
0 items
New Products
Product Details
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
CoolBank 1/16 Military Truck 1/16 Opel Blitz German WWII Truck
Brand:Cool Bank
Product Code:hKtGspX
Product Condition:New
£100.00 inc. tax
£83.33 ex. tax
? Tax based on United Kingdom.
Add to Cart
Description
Dispatch time : Nov. 13-18,2026
Bring history to life with the highly detailed CoolBank 1/16 scale Opel Blitz RC Military Truck. This ready-to-run (RTR) model is a stunning replica of the legendary World War II German 3-ton workhorse, blending authentic scale realism with modern hobby-grade RC performance.
Perfect for military history buffs, scale builders, and RC collectors alike, this truck features a simulated wooden storage box on the bed that houses a built-in sound system. Experience a realistic startup sequence that even models a manual hand-crank routine before the engine roars to life!
Key Features:
  • Stunning Scale Realism: Includes a beautifully painted military finish, authentic Balkenkreuz markings, realistic scale accessories (like a side-mounted spade), and a fully functional drop-side cargo bed held securely by magnets.
  • Proportional Control: Features a 370-sized brushed motor paired with a smooth planetary gearbox and a hobby-grade 3-wire steering servo for precise handling.
  • Dynamic Lights & Sound: Equipped with working headlights, a blackout light, and dashboard illumination. The integrated sound module mimics authentic engine sounds, fully controllable right from the transmitter.
  • Leaf Spring Suspension: Authentic rear-wheel-drive (RWD) drivetrain supported by functional leaf spring suspension to mimic the physics of the real truck.
  • Ready to Run: Comes with a 2.4GHz stick-style transmitter, a 7.4V 500mAh 2S Li-ion battery pack, and a USB charging adapter.
Specifications:
  • Scale: 1/16
  • Motor: 370 Brushed Motor
  • Battery: 7.4V 2S Li-ion (500mAh)
  • Drive System: Rear Wheel Drive (RWD)
  • Radio System: 2.4GHz Stick Transmitter 
What’s in the Box:
  • 1 x CoolBank 1/16 Opel Blitz RC Truck
  • 1 x 2.4GHz Radio Transmitter
  • 1 x 7.4V Li-ion Battery
  • 1 x USB Charging Cable
  • Scale Accessory Parts & Manual

Watch Video Below !

Updating Order Details
Please do not refresh or navigate away from the page!
Reviews
No Reviews Posted Yet - be the first!
write review
Product Added to your Cart
x

-------- OR --------

Withdraw from contract